−44%Testing pending
GHRH & Secretagogue
Representative render — packaging may vary
IGF-1 LR3
Also indexed as Long R3 IGF-1 · LR3 IGF-1 · Long R3 insulin-like growth factor 1
Research Use OnlyTesting pending
No independent assay has been published for this product yet. Nothing shown on this page is a measurement of the material in stock.
All products currently listed on this site are for research purposes only.
An 83-residue recombinant analogue of insulin-like growth factor 1 engineered for reduced binding-protein affinity.
Size
$51.99
$92.00
Save 43%Shown with code SAVE20 · your cart shows $64.99 until you enter it at checkout
per unit · EP-IGF-001
Ships in 8–10 days
1
Order before 2:00 pm ET for same-day dispatch
Paid & cleared by 2:00 pm ET · Mon–Fri, excluding holidaysTracked delivery with FedEx & USPS
Delivery time depends on your service and destination. See shipping detailsAdd 2 more to reach $61.74 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $64.99 | — |
| 3–5 | $61.74 | 5% |
| 6–8 | $58.49 | 10% |
| 9+ | $55.24 | 15% |
No independent assay has been published for the 1mg lot yet. Its certificate appears here when it is completed. Until then nothing published for this product is a measurement of the material in the vial.
Literature
Research context
Long R3 IGF-1 carries a glutamate-to-arginine substitution at position 3 and a 13-residue N-terminal extension. Both modifications sharply lower affinity for the IGF-binding proteins, which is why the analogue is the standard IGF-1 receptor agonist in serum-free cell culture and bioprocess media literature.
Documented research areas
- IGF-1 receptor agonism
- IGFBP binding-affinity engineering
- Serum-free cell culture supplementation
- PI3K/Akt and MAPK growth signalling
Specification
Chemistry
- CAS number
- 946870-92-4
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9117.6 g/mol
- Form
- Lyophilized powder
- Appears in
- 4 documented research areas
- Amino acid sequence
- MFPAMPLLSLFVNGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Laboratory
Storage and handling
Storage
Store lyophilized powder at -20°C. Avoid repeated freeze-thaw once reconstituted.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
- −44%
−35%Testing pending
−44%Testing pending