−43%Testing pending
GHRH & Secretagogue
Representative render — packaging may vary
Sermorelin
Also indexed as GRF(1-29) · GHRH(1-29) amide · Geref
Research Use OnlyTesting pending
No independent assay has been published for this product yet. Nothing shown on this page is a measurement of the material in stock.
All products currently listed on this site are for research purposes only.
The native 29-residue N-terminal fragment of GH-releasing hormone (GHRH) — the minimal fully active GHRH sequence.
Size
$31.99
$49.50
Save 35%Shown with code SAVE20 · your cart shows $39.99 until you enter it at checkout
per unit · EP-SRM-005
Ships in 8–10 days
1
Order before 2:00 pm ET for same-day dispatch
Paid & cleared by 2:00 pm ET · Mon–Fri, excluding holidaysTracked delivery with FedEx & USPS
Delivery time depends on your service and destination. See shipping detailsAdd 2 more to reach $37.99 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $39.99 | — |
| 3–5 | $37.99 | 5% |
| 6–8 | $35.99 | 10% |
| 9+ | $33.99 | 15% |
No independent assay has been published for the 5mg lot yet. Its certificate appears here when it is completed. Until then nothing published for this product is a measurement of the material in the vial.
Literature
Research context
Sermorelin is unmodified GHRH(1-29) amide, the shortest fragment that retains full receptor activity. It is the parent sequence from which Mod GRF and CJC-1295 were engineered, and appears throughout the endocrine literature as the reference GHRH agonist in pituitary function studies and receptor-binding assays.
Documented research areas
- GHRH receptor agonism
- Pituitary somatotroph function studies
- GHRH fragment structure-activity relationships
- Peptide degradation by DPP-4
Specification
Chemistry
- CAS number
- 86168-78-7
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.93 g/mol
- Form
- Lyophilized powder
- Appears in
- 4 documented research areas
- Amino acid sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Laboratory
Storage and handling
Storage
Store lyophilized at -20°C, protected from light and moisture.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
- −43%
−44%Testing pending
−44%Testing pending