Representative render — packaging may vary
Exenatide
Also indexed as Exendin-4 · AC2993
All products currently listed on this site are for research purposes only.
A 39-residue peptide first characterised in Heloderma suspectum venom and the structural template for modern incretin analogues.
Size
$119.00
per unit · EP-EXN-005
Add 2 more to reach $109.00 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $119.00 | — |
| 3+ | $109.00 | 8% |
| 5+ | $99.00 | 17% |
Certificate of analysis
Lot EP-EXN-2604A
98.7%
Assayed purity
Guaranteed floor 99%
- Tested
- April 30, 2026
- Laboratory
- Janoshik Analytical
- Methods
- HPLCMS
Literature
Research context
Exendin-4 shares roughly 53% sequence identity with human GLP-1 but resists DPP-4 cleavage because of its glycine at position 2. The literature covers its discovery in Gila monster venom, its C-terminal Trp-cage extension, and its long-standing use as the backbone scaffold in engineered incretin co-agonists.
Documented research areas
- GLP-1 receptor agonism
- DPP-4 resistance and peptide stability
- Trp-cage structural motif
- Venom-derived peptide discovery
Specification
Chemistry
- CAS number
- 141758-74-9
- Molecular formula
- C184H282N50O60S
- Molecular weight
- 4186.57 g/mol
- Form
- Lyophilized powder
- Purity floor
- ≥ 99%
- Appears in
- 4 documented research areas
- Amino acid sequence
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Laboratory
Storage and handling
Storage
Store lyophilized powder at -20°C, protected from light.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
Incretin & Metabolic5-Amino-1MQ
5-amino-1-methylquinolinium
A quaternary quinolinium small molecule described in the literature as a selective inhibitor of nicotinamide N-methyltransferase.
Capsule≥98.5% purityLot assayed 99%From
$59.00
2 sizes
Research Use Only- Incretin & Metabolic
Tesofensine
NS2330
A tropane-derived small molecule characterised in the literature as a triple reuptake inhibitor of noradrenaline, dopamine and serotonin.
Capsule≥98.5% purityLot assayed 98.9%From
$89.00
1 size
Research Use Only - NewIncretin & Metabolic
Survodutide
BI 456906
A 29-residue dual agonist of the glucagon and GLP-1 receptors carrying a C18 fatty-acid conjugate.
Lyophilized powder≥99% purityLot assayed 98.8%From
$139.00
1 size
Research Use Only