Representative render — packaging may vary
LL-37
Also indexed as Cathelicidin LL-37 · hCAP-18(134-170) · CAMP gene product
All products currently listed on this site are for research purposes only.
The only human cathelicidin — a 37-residue amphipathic helical peptide at the centre of the innate-immunity literature.
Size
$139.00
per unit · EP-L37-005
Add 2 more to reach $127.00 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $139.00 | — |
| 3+ | $127.00 | 9% |
| 5+ | $114.00 | 18% |
Certificate of analysis
Lot EP-L37-2605A
98.8%
Assayed purity
Guaranteed floor 98.5%
- Tested
- May 29, 2026
- Laboratory
- Janoshik Analytical
- Methods
- HPLCLC-MS
Literature
Research context
LL-37 is released by proteinase-3 cleavage of the hCAP-18 precursor. Published work covers membrane permeabilisation of Gram-positive and Gram-negative bacteria, LPS neutralisation, biofilm disruption assays, and chemotactic signalling through FPRL1 on immune cells. It is the reference antimicrobial peptide in most comparative studies.
Documented research areas
- Antimicrobial membrane permeabilisation
- LPS neutralisation and endotoxin binding
- Biofilm disruption assays
- FPRL1 chemotactic signalling
Specification
Chemistry
- CAS number
- 154947-66-7
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.33 g/mol
- Form
- Lyophilized powder
- Purity floor
- ≥ 98.5%
- Appears in
- 4 documented research areas
- Amino acid sequence
- [LL-37, 37 aa]
Laboratory
Storage and handling
Storage
Store lyophilized at -20°C. Use low-binding plasticware once in solution.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
Best sellerTissue & AngiogenesisBPC-157
Body Protection Compound 157
A fifteen-amino-acid sequence derived from human gastric juice protein, among the most extensively studied compounds in soft-tissue research.
Lyophilized powder≥99% purityLot assayed 99.4%From
$49.00
2 sizes
Research Use Only- Tissue & Angiogenesis
Thymosin Alpha-1
Tα1
A 28-residue acetylated thymic peptide, one of the most-cited immunomodulatory sequences in the peptide literature.
Lyophilized powder≥99% purityLot assayed 99.4%From
$89.00
2 sizes
Research Use Only - Tissue & Angiogenesis
Thymosin Beta-4
Tβ4
The full 43-residue actin-sequestering peptide from which TB-500 is derived — the parent molecule, not the fragment.
Lyophilized powder≥98.5% purityLot assayed 98.8%From
$139.00
1 size
Research Use Only