
Representative render — packaging may vary
IGF-1 LR3
Also indexed as Long R3 IGF-1 · LR3 IGF-1 · Long R3 insulin-like growth factor 1
All products currently listed on this site are for research purposes only.
An 83-residue recombinant analogue of insulin-like growth factor 1 engineered for reduced binding-protein affinity.
Size
$99.00
per unit · EP-IGF-001
Add 2 more to reach $90.00 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $99.00 | — |
| 3+ | $90.00 | 9% |
| 5+ | $81.00 | 18% |
Certificate of analysis
Lot EP-IGF-2606A
98.9%
Assayed purity
Guaranteed floor 98%
- Tested
- June 23, 2026
- Laboratory
- Janoshik Analytical
- Methods
- HPLCLC-MS
Literature
Research context
Long R3 IGF-1 carries a glutamate-to-arginine substitution at position 3 and a 13-residue N-terminal extension. Both modifications sharply lower affinity for the IGF-binding proteins, which is why the analogue is the standard IGF-1 receptor agonist in serum-free cell culture and bioprocess media literature.
Documented research areas
- IGF-1 receptor agonism
- IGFBP binding-affinity engineering
- Serum-free cell culture supplementation
- PI3K/Akt and MAPK growth signalling
Specification
Chemistry
- CAS number
- 946870-92-4
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9117.6 g/mol
- Form
- Lyophilized powder
- Purity floor
- ≥ 98%
- Appears in
- 4 documented research areas
- Amino acid sequence
- MFPAMPLLSLFVNGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Laboratory
Storage and handling
Storage
Store lyophilized powder at -20°C. Avoid repeated freeze-thaw once reconstituted.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
Androgen & Growth AxisFollistatin-344
FST-344
A recombinant 344-residue glycoprotein isoform of follistatin, the canonical high-affinity binder of activin A and myostatin.
Lyophilized powder≥98% purityLot assayed 98.5%From
$249.00
1 size
Research Use Only
Androgen & Growth AxisYK-11
YK11
A steroidal androgen receptor ligand studied for partial agonism and for follistatin expression in myoblast culture.
Solution≥98.5% purityLot assayed 98.7%From
$74.00
1 size
Research Use Only
Androgen & Growth AxisMK-677
Ibutamoren
A spiropiperidine GH secretagogue that acts as a non-peptide agonist at the ghrelin receptor GHS-R1a.
Solution≥98.5% purityLot assayed 99.1%From
$69.00
2 sizes
Research Use Only