Representative render — packaging may vary
Sermorelin
Also indexed as GRF(1-29) · GHRH(1-29) amide · Geref
All products currently listed on this site are for research purposes only.
The native 29-residue N-terminal fragment of GH-releasing hormone (GHRH) — the minimal fully active GHRH sequence.
Size
$59.00
per unit · EP-SRM-005
Add 2 more to reach $53.00 per unit.
| Quantity | Unit price | Saving |
|---|---|---|
| 1–2 | $59.00 | — |
| 3+ | $53.00 | 10% |
| 5+ | $48.00 | 19% |
Certificate of analysis
Lot EP-SRM-2606A
99.2%
Assayed purity
Guaranteed floor 99%
- Tested
- June 8, 2026
- Laboratory
- Janoshik Analytical
- Methods
- HPLCMS
Literature
Research context
Sermorelin is unmodified GHRH(1-29) amide, the shortest fragment that retains full receptor activity. It is the parent sequence from which Mod GRF and CJC-1295 were engineered, and appears throughout the endocrine literature as the reference GHRH agonist in pituitary function studies and receptor-binding assays.
Documented research areas
- GHRH receptor agonism
- Pituitary somatotroph function studies
- GHRH fragment structure-activity relationships
- Peptide degradation by DPP-4
Specification
Chemistry
- CAS number
- 86168-78-7
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.93 g/mol
- Form
- Lyophilized powder
- Purity floor
- ≥ 99%
- Appears in
- 4 documented research areas
- Amino acid sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Laboratory
Storage and handling
Storage
Store lyophilized at -20°C, protected from light and moisture.
Handling
For laboratory use by qualified personnel only.
Research use only. This material is supplied for laboratory research by qualified personnel. It is not a drug, food, cosmetic or household product, and it is not for human or veterinary use. See our research use policy and prohibited uses.
Sources
Selected references
External links open in a new tab. Ethereal Peptides is not affiliated with the publishers or the authors listed.
Nearby
Studied alongside
Androgen & Growth AxisMK-677
Ibutamoren
A spiropiperidine GH secretagogue that acts as a non-peptide agonist at the ghrelin receptor GHS-R1a.
Solution≥98.5% purityLot assayed 99.1%From
$69.00
2 sizes
Research Use Only
Androgen & Growth AxisSR-9009
Stenabolic
A synthetic agonist of the nuclear receptors REV-ERBα and REV-ERBβ, used as a chemical probe in circadian biology.
Solution≥98.5% purityLot assayed 98.5%From
$62.00
1 size
Research Use Only- Mitochondrial & Cellular
Epithalon
Epitalon
A synthetic tetrapeptide modelled on the pineal extract epithalamin, and the most-cited compound in the telomerase-activation literature.
Lyophilized powder≥99% purityLot assayed 99.6%From
$49.00
2 sizes
Research Use Only